SCOPe 2.08: Domain d1evtd2: 1evt D:251-359

Lineage for d1evtd2 (1evt D:251-359)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.4: I set domains [49159] (39 proteins)
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (3 PDB entries)
Domain d1evtd2: 1evt D:251-359 [21733]
Other proteins in same PDB: d1evta_, d1evtb_
complexed with so4

Details for d1evtd2

PDB Entry: 1evt (more details), 2.8 Å

PDB Description: crystal structure of fgf1 in complex with the extracellular ligand binding domain of fgf receptor 1 (fgfr1)

PDB Compounds: (D:) protein (fibroblast growth factor receptor 1)

SCOPe Domain Sequences for d1evtd2:

Sequence, based on SEQRES records: (download)

>d1evtd2 b.1.1.4 (D:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqi
lktagvnttdkemevlhlrnvsfedageytclagnsiglshhsawltvl

Sequence, based on observed residues (ATOM records): (download)

>d1evtd2 b.1.1.4 (D:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhipyvqilktaevlhlrnv
sfedageytclagnsiglshhsawltvl

SCOPe Domain Coordinates for d1evtd2:

Click to download the PDB-style file with coordinates for d1evtd2.
(The format of our PDB-style files is described here.)

Timeline for d1evtd2: