SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3ue5a1 (3ue5 A:5-146)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2122051Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2122052Family c.55.1.1: Actin/HSP70 [53068] (8 protein domains)
  6. 2122053Protein Actin [53073] (8 species)
  7. 2122079Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (62 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 2122180Domain d3ue5a1: 3ue5 A:5-146 [217324]
    automated match to d1qz5a1
    complexed with atp, ca, cl

Details for d3ue5a1

PDB Entry: 3ue5 (more details), 2.76 Å

PDB Description: ECP-cleaved Actin in complex with Spir domain D
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d3ue5a1:

Sequence, based on SEQRES records: (download)

>d3ue5a1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d3ue5a1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgkdsyvgdeaqskrgiltlkypi
ehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpa
myvaiqavlslyasg

SCOPe Domain Coordinates for d3ue5a1:

Click to download the PDB-style file with coordinates for d3ue5a1.
(The format of our PDB-style files is described here.)

Timeline for d3ue5a1: