SCOPe 2.04: Domain d3ue4a_: 3ue4 A:

Lineage for d3ue4a_ (3ue4 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (490 PDB entries)

8. Domain d3ue4a_: 3ue4 A: [217322]
   automated match to d3kf4a_
   complexed with db8

Details for d3ue4a_

PDB Entry: 3ue4, 2.42 Å

PDB Description: Structural and spectroscopic analysis of the kinase inhibitor bosutinib binding to the Abl tyrosine kinase domain

PDB Compounds: (A:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3ue4a_:

Sequence; same for both SEQRES and ATOM records:

>d3ue4a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke
ikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissame
ylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesla
ynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelm
racwqwnpsdrpsfaeihqafetmfqessi

Timeline for d3ue4a_:

• d3ue4a_ first appeared in SCOPe 2.03
  
• d3ue4a_ appears in SCOPe 2.05
  
• d3ue4a_ appears in the current release, SCOPe 2.08