SCOP 1.59: Domain d1evtd1: 1evt D:147-250

Lineage for d1evtd1 (1evt D:147-250)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.4: I set domains [49159] (25 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)

7. Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (3 PDB entries)

8. Domain d1evtd1: 1evt D:147-250 [21732]
   Other proteins in same PDB: d1evta_, d1evtb_

Details for d1evtd1

PDB Entry: 1evt, 2.8 Å

PDB Description: crystal structure of fgf1 in complex with the extracellular ligand binding domain of fgf receptor 1 (fgfr1)

SCOP Domain Sequences for d1evtd1:

Sequence; same for both SEQRES and ATOM records:

>d1evtd1 b.1.1.4 (D:147-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1}
nrmpvapywtspekmekklhavpaaktvkfkcpssgtpnptlrwlkngkefkpdhriggy
kvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvver

Timeline for d1evtd1:

• d1evtd1 first appeared (with stable ids) in SCOP 1.55
  
• d1evtd1 appears in SCOP 1.57
  
• d1evtd1 appears in SCOP 1.61
  
• d1evtd1 appears in the current release, SCOPe 2.08