SCOPe 2.05: Domain d3ud9c_: 3ud9 C:

Lineage for d3ud9c_ (3ud9 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (92 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d3ud9c_: 3ud9 C: [217310]
   automated match to d1q03a_
   complexed with po4

Details for d3ud9c_

PDB Entry: 3ud9, 2.34 Å

PDB Description: crystal structure analysis of fgf1-disaccharide(ni23) complex

PDB Compounds: (C:) heparin-binding growth factor 1

SCOPe Domain Sequences for d3ud9c_:

Sequence; same for both SEQRES and ATOM records:

>d3ud9c_ b.42.1.1 (C:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
ilflplp

Timeline for d3ud9c_:

• d3ud9c_ first appeared in SCOPe 2.03
  
• d3ud9c_ appears in SCOPe 2.04
  
• d3ud9c_ appears in SCOPe 2.06
  
• d3ud9c_ appears in the current release, SCOPe 2.08