Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) |
Domain d1evtc2: 1evt C:251-359 [21731] Other proteins in same PDB: d1evta_, d1evtb_ complexed with so4 |
PDB Entry: 1evt (more details), 2.8 Å
SCOPe Domain Sequences for d1evtc2:
Sequence, based on SEQRES records: (download)
>d1evtc2 b.1.1.4 (C:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqi lktagvnttdkemevlhlrnvsfedageytclagnsiglshhsawltvl
>d1evtc2 b.1.1.4 (C:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhinlpyvqilevlhlrnvs fedageytclagnsiglshhsawltvl
Timeline for d1evtc2:
View in 3D Domains from other chains: (mouse over for more information) d1evta_, d1evtb_, d1evtd1, d1evtd2 |