SCOP 1.55: Domain d1evtc2: 1evt C:251-359

Lineage for d1evtc2 (1evt C:251-359)

Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.4: I set domains [49159] (21 proteins)
Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)
Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (3 PDB entries)
Domain d1evtc2: 1evt C:251-359 [21731]
Other proteins in same PDB: d1evta_, d1evtb_

Details for d1evtc2

PDB Entry: 1evt (more details), 2.8 Å

PDB Description: crystal structure of fgf1 in complex with the extracellular ligand binding domain of fgf receptor 1 (fgfr1)

SCOP Domain Sequences for d1evtc2:

Sequence, based on SEQRES records: (download)

>d1evtc2 b.1.1.4 (C:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1}
sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqi
lktagvnttdkemevlhlrnvsfedageytclagnsiglshhsawltvl

Sequence, based on observed residues (ATOM records): (download)

>d1evtc2 b.1.1.4 (C:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1}
sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhinlpyvqilevlhlrnvs
fedageytclagnsiglshhsawltvl

SCOP Domain Coordinates for d1evtc2:

Click to download the PDB-style file with coordinates for d1evtc2.
(The format of our PDB-style files is described here.)

Timeline for d1evtc2: