Lineage for d1evtc2 (1evt C:251-359)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2354769Family b.1.1.4: I set domains [49159] (39 protein domains)
  6. 2354850Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (3 PDB entries)
  8. 2354857Domain d1evtc2: 1evt C:251-359 [21731]
    Other proteins in same PDB: d1evta_, d1evtb_
    complexed with so4

Details for d1evtc2

PDB Entry: 1evt (more details), 2.8 Å

PDB Description: crystal structure of fgf1 in complex with the extracellular ligand binding domain of fgf receptor 1 (fgfr1)
PDB Compounds: (C:) protein (fibroblast growth factor receptor 1)

SCOPe Domain Sequences for d1evtc2:

Sequence, based on SEQRES records: (download)

>d1evtc2 b.1.1.4 (C:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqi
lktagvnttdkemevlhlrnvsfedageytclagnsiglshhsawltvl

Sequence, based on observed residues (ATOM records): (download)

>d1evtc2 b.1.1.4 (C:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhinlpyvqilevlhlrnvs
fedageytclagnsiglshhsawltvl

SCOPe Domain Coordinates for d1evtc2:

Click to download the PDB-style file with coordinates for d1evtc2.
(The format of our PDB-style files is described here.)

Timeline for d1evtc2: