SCOPe 2.08: Domain d1evtc2: 1evt C:251-359

Lineage for d1evtc2 (1evt C:251-359)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)

7. Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (3 PDB entries)

8. Domain d1evtc2: 1evt C:251-359 [21731]
   Other proteins in same PDB: d1evta_, d1evtb_
   complexed with so4

Details for d1evtc2

PDB Entry: 1evt, 2.8 Å

PDB Description: crystal structure of fgf1 in complex with the extracellular ligand binding domain of fgf receptor 1 (fgfr1)

PDB Compounds: (C:) protein (fibroblast growth factor receptor 1)

SCOPe Domain Sequences for d1evtc2:

Sequence, based on SEQRES records:

>d1evtc2 b.1.1.4 (C:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqi
lktagvnttdkemevlhlrnvsfedageytclagnsiglshhsawltvl

Sequence, based on observed residues (ATOM records):

>d1evtc2 b.1.1.4 (C:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhinlpyvqilevlhlrnvs
fedageytclagnsiglshhsawltvl

Timeline for d1evtc2:

• d1evtc2 first appeared (with stable ids) in SCOP 1.55
  
• d1evtc2 appears in SCOPe 2.07