SCOPe 2.06: Domain d3ud8b_: 3ud8 B:

Lineage for d3ud8b_ (3ud8 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d3ud8b_: 3ud8 B: [217306]
   automated match to d1q03a_
   complexed with po4

Details for d3ud8b_

PDB Entry: 3ud8, 2.37 Å

PDB Description: crystal structure analysis of fgf1-disaccharide(ni22) complex

PDB Compounds: (B:) heparin-binding growth factor 1

SCOPe Domain Sequences for d3ud8b_:

Sequence; same for both SEQRES and ATOM records:

>d3ud8b_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
ilflplpv

Timeline for d3ud8b_:

• d3ud8b_ first appeared in SCOPe 2.03
  
• d3ud8b_ appears in SCOPe 2.05
  
• d3ud8b_ appears in SCOPe 2.07
  
• d3ud8b_ appears in the current release, SCOPe 2.08