Lineage for d3ud7c_ (3ud7 C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543031Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1543032Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1543033Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 1543047Species Human (Homo sapiens) [TaxId:9606] [50359] (84 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 1543218Domain d3ud7c_: 3ud7 C: [217304]
    automated match to d1q03a_
    complexed with po4

Details for d3ud7c_

PDB Entry: 3ud7 (more details), 2.8 Å

PDB Description: crystal structure analysis of fgf1-disaccharide(ni21) complexes
PDB Compounds: (C:) heparin-binding growth factor 1

SCOPe Domain Sequences for d3ud7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ud7c_ b.42.1.1 (C:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
pkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtd
gllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqkai
lflplpv

SCOPe Domain Coordinates for d3ud7c_:

Click to download the PDB-style file with coordinates for d3ud7c_.
(The format of our PDB-style files is described here.)

Timeline for d3ud7c_: