Lineage for d3ucsd_ (3ucs D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689868Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 2689904Family a.2.3.0: automated matches [191473] (1 protein)
    not a true family
  6. 2689905Protein automated matches [190750] (8 species)
    not a true protein
  7. 2689912Species Escherichia coli K-12 [TaxId:83333] [226715] (2 PDB entries)
  8. 2689914Domain d3ucsd_: 3ucs D: [217300]
    Other proteins in same PDB: d3ucsc2
    automated match to d1xbla_

Details for d3ucsd_

PDB Entry: 3ucs (more details), 1.87 Å

PDB Description: crystal structure of the complex between cbpa j-domain and cbpm
PDB Compounds: (D:) Curved DNA-binding protein

SCOPe Domain Sequences for d3ucsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ucsd_ a.2.3.0 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lkdyyaimgvkptddlktiktayrrlarkyhpdvskepdaearfkevaeawevlsdeqrr
aeydqmwqh

SCOPe Domain Coordinates for d3ucsd_:

Click to download the PDB-style file with coordinates for d3ucsd_.
(The format of our PDB-style files is described here.)

Timeline for d3ucsd_: