SCOPe 2.06: Domain d3ucfc_: 3ucf C:

Lineage for d3ucfc_ (3ucf C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:196600] [226533] (2 PDB entries)

8. Domain d3ucfc_: 3ucf C: [217296]
   automated match to d3vtzc_

Details for d3ucfc_

PDB Entry: 3ucf, 2.35 Å

PDB Description: Crystal structure of a small-chain dehydrogenase

PDB Compounds: (C:) dehydrogenase

SCOPe Domain Sequences for d3ucfc_:

Sequence, based on SEQRES records:

>d3ucfc_ c.2.1.0 (C:) automated matches {Vibrio vulnificus [TaxId: 196600]}
dktvyvvlggtsgigaelakqlesehtivhvasrqtgldisdeksvyhyfetigafdhli
vtagsyapagkvvdvevtqakyafdtkfwgavlaakhgarylkqggsitltsgmlsrkvv
antyvkaainaaieattkvlakelapirvnaispgltkteaykgmnaddrdamyqrtqsh
lpvgkvgeasdiamaylfaiqnsymtgtvidvdggallg

Sequence, based on observed residues (ATOM records):

>d3ucfc_ c.2.1.0 (C:) automated matches {Vibrio vulnificus [TaxId: 196600]}
dktvyvvlggtsgigaelakqlesehtivhvasrqtgldisdeksvyhyfetigafdhli
vtagsyapagkvvdvevtqakyafdtkfwgavlaakhgarylkqggsitltsgmlsrkvv
antyvkaainaaieattkvlakelapirvnaispgltkrdamyqrtqshlpvgkvgeasd
iamaylfaiqnsymtgtvidvdggallg

Timeline for d3ucfc_:

• d3ucfc_ first appeared in SCOPe 2.03
  
• d3ucfc_ appears in SCOPe 2.05
  
• d3ucfc_ appears in SCOPe 2.07
  
• d3ucfc_ appears in the current release, SCOPe 2.08