Lineage for d3uced_ (3uce D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1832596Species Vibrio vulnificus [TaxId:196600] [226533] (2 PDB entries)
  8. 1832600Domain d3uced_: 3uce D: [217293]
    automated match to d3vtzc_
    complexed with ndp

Details for d3uced_

PDB Entry: 3uce (more details), 1.8 Å

PDB Description: Crystal structure of a small-chain dehydrogenase in complex with NADPH
PDB Compounds: (D:) dehydrogenase

SCOPe Domain Sequences for d3uced_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uced_ c.2.1.0 (D:) automated matches {Vibrio vulnificus [TaxId: 196600]}
dktvyvvlggtsgigaelakqlesehtivhvasrqtgldisdeksvyhyfetigafdhli
vtagsyapagkvvdvevtqakyafdtkfwgavlaakhgarylkqggsitltsgmlsrkvv
antyvkaainaaieattkvlakelapirvnaispgltkteaykgmnaddrdamyqrtqsh
lpvgkvgeasdiamaylfaiqnsymtgtvidvdggallg

SCOPe Domain Coordinates for d3uced_:

Click to download the PDB-style file with coordinates for d3uced_.
(The format of our PDB-style files is described here.)

Timeline for d3uced_: