SCOPe 2.08: Domain d3uceb_: 3uce B:

Lineage for d3uceb_ (3uce B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:196600] [226533] (2 PDB entries)

8. Domain d3uceb_: 3uce B: [217291]
   automated match to d3vtzc_
   complexed with ndp

Details for d3uceb_

PDB Entry: 3uce, 1.8 Å

PDB Description: Crystal structure of a small-chain dehydrogenase in complex with NADPH

PDB Compounds: (B:) dehydrogenase

SCOPe Domain Sequences for d3uceb_:

Sequence; same for both SEQRES and ATOM records:

>d3uceb_ c.2.1.0 (B:) automated matches {Vibrio vulnificus [TaxId: 196600]}
dktvyvvlggtsgigaelakqlesehtivhvasrqtgldisdeksvyhyfetigafdhli
vtagsyapagkvvdvevtqakyafdtkfwgavlaakhgarylkqggsitltsgmlsrkvv
antyvkaainaaieattkvlakelapirvnaispgltkteaykgmnaddrdamyqrtqsh
lpvgkvgeasdiamaylfaiqnsymtgtvidvdggallg

Timeline for d3uceb_:

• d3uceb_ first appeared in SCOPe 2.03
  
• d3uceb_ appears in SCOPe 2.07