SCOPe 2.06: Domain d3ucdb1: 3ucd B:1-139

Lineage for d3ucdb1 (3ucd B:1-139)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (10 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (15 PDB entries)
   Uniprot P09104

8. Domain d3ucdb1: 3ucd B:1-139 [217288]
   Other proteins in same PDB: d3ucda2, d3ucdb2
   automated match to d1pdza2
   complexed with 2pg, mg, pep

Details for d3ucdb1

PDB Entry: 3ucd, 1.41 Å

PDB Description: asymmetric complex of human neuron specific enolase-2-pga/pep

PDB Compounds: (B:) Gamma-enolase

SCOPe Domain Sequences for d3ucdb1:

Sequence; same for both SEQRES and ATOM records:

>d3ucdb1 d.54.1.1 (B:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siqkiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

Timeline for d3ucdb1:

• d3ucdb1 first appeared in SCOPe 2.03
  
• d3ucdb1 appears in SCOPe 2.05
  
• d3ucdb1 appears in SCOPe 2.07
  
• d3ucdb1 appears in the current release, SCOPe 2.08