| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
| Protein Enolase [51606] (9 species) Fold of this protein slightly differs from common fold in topology |
| Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (9 PDB entries) Uniprot P09104 |
| Domain d3ucca2: 3ucc A:140-433 [217283] Other proteins in same PDB: d3ucca1, d3uccb1 automated match to d1pdza1 complexed with 2pg, mg, trs |
PDB Entry: 3ucc (more details), 1.5 Å
SCOPe Domain Sequences for d3ucca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ucca2 c.1.11.1 (A:140-433) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky
gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld
fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl
tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsvl
Timeline for d3ucca2: