Lineage for d3ucab_ (3uca B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1281954Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1281955Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1282215Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1282216Protein automated matches [196409] (21 species)
    not a true protein
  7. 1282223Species Clostridium perfringens [TaxId:1502] [226250] (1 PDB entry)
  8. 1282225Domain d3ucab_: 3uca B: [217279]
    automated match to d1rqjb_

Details for d3ucab_

PDB Entry: 3uca (more details), 2 Å

PDB Description: crystal structure of isoprenoid synthase (target efi-501974) from clostridium perfringens
PDB Compounds: (B:) Geranyltranstransferase

SCOPe Domain Sequences for d3ucab_:

Sequence, based on SEQRES records: (download)

>d3ucab_ a.128.1.0 (B:) automated matches {Clostridium perfringens [TaxId: 1502]}
amninslkeevdqslkayfnkdreynkvlydsmaysinvggkrirpilmllsyyiyksdy
kkiltpamaiemihtyslihddlpcmdnddlrrgkptnhkvfgeaiavlagdallneamk
ilvdysleegksalkatkiiadaagsdgmiggqivdiinedkeeislkeldymhlkktge
likasimsgavlaeasegdikklegfgyklglafqikddildvvgnakdlgknvhkdqes
nknnyitifgleeckkkcvniteecieilssikgnteplkvltmkllerkf

Sequence, based on observed residues (ATOM records): (download)

>d3ucab_ a.128.1.0 (B:) automated matches {Clostridium perfringens [TaxId: 1502]}
amninslkeevdqslkayfnkdreynkvlydsmaysinvggkrirpilmllsyyiyksdy
kkiltpamaiemihtyslihddlpcmdnddlrrgkptnhkvfgeaiavlagdallneamk
ilvdysleegksalkatkiiadaagsdgmiggqivdiinedslkeldymhlkktgelika
simsgavlaeasegdikklegfgyklglafqikddildvvnnyitifgleeckkkcvnit
eecieilssikgnteplkvltmkllerkf

SCOPe Domain Coordinates for d3ucab_:

Click to download the PDB-style file with coordinates for d3ucab_.
(The format of our PDB-style files is described here.)

Timeline for d3ucab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ucaa_