Lineage for d3uc1a1 (3uc1 A:514-819)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2399031Superfamily b.68.10: GyrA/ParC C-terminal domain-like [101904] (2 families) (S)
    beta-pinwheel, a variant of beta-propeller fold; unlike an canonical beta-propeller, strands 1 and 4 of each four-strand repeat unit are in one blade whereas strands 2 and 3 are in the next blade
  5. 2399039Family b.68.10.0: automated matches [227275] (1 protein)
    not a true family
  6. 2399040Protein automated matches [227082] (2 species)
    not a true protein
  7. 2399044Species Mycobacterium tuberculosis [TaxId:83332] [226342] (2 PDB entries)
  8. 2399046Domain d3uc1a1: 3uc1 A:514-819 [217277]
    Other proteins in same PDB: d3uc1a2
    automated match to d1suua_
    complexed with act, ca, gol

Details for d3uc1a1

PDB Entry: 3uc1 (more details), 1.65 Å

PDB Description: Mycobacterium tuberculosis gyrase type IIA topoisomerase C-terminal domain
PDB Compounds: (A:) DNA gyrase subunit A

SCOPe Domain Sequences for d3uc1a1:

Sequence, based on SEQRES records: (download)

>d3uc1a1 b.68.10.0 (A:514-819) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
edvvvtitetgyakrtktdlyrsqkrggkgvqgaglkqddivahffvcsthdlilffttq
grvyrakaydlpeasrtargqhvanllafqpeeriaqviqirgytdapylvlatrnglvk
kskltdfdsnrsggivavnlrdndelvgavlcsagddlllvsangqsirfsatdealrpm
gratsgvqgmrfniddrllslnvvregtyllvatsggyakrtaieeypvqgrggkgvltv
mydrrrgrlvgalivdddselyavtsgggvirtaarqvrkagrqtkgvrlmnlgegdtll
aiarna

Sequence, based on observed residues (ATOM records): (download)

>d3uc1a1 b.68.10.0 (A:514-819) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
edvvvtitetgyakrtktdlyrsqkaglkqddivahffvcsthdlilffttqgrvyraka
ydlpeasrtargqhvanllafqpeeriaqviqirgytdapylvlatrnglvkkskltdfd
snrsggivavnlrdndelvgavlcsagddlllvsangqsirfsatdealrpmgratsgvq
gmrfniddrllslnvvregtyllvatsggyakrtaieeypvqgrggkgvltvmydrrrgr
lvgalivdddselyavtsgggvirtaarqvrkagrqtkgvrlmnlgegdtllaiarna

SCOPe Domain Coordinates for d3uc1a1:

Click to download the PDB-style file with coordinates for d3uc1a1.
(The format of our PDB-style files is described here.)

Timeline for d3uc1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uc1a2