Lineage for d3uc0l2 (3uc0 L:109-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749868Species Chimpanzee (Pan troglodytes) [TaxId:9598] [226268] (1 PDB entry)
  8. 2749869Domain d3uc0l2: 3uc0 L:109-210 [217274]
    Other proteins in same PDB: d3uc0h_, d3uc0i_, d3uc0l1, d3uc0m1
    automated match to d1rhha2
    complexed with gol, so4

Details for d3uc0l2

PDB Entry: 3uc0 (more details), 2.71 Å

PDB Description: crystal structure of domain i of the envelope glycoprotein ectodomain from dengue virus serotype 4 in complex with the fab fragment of the chimpanzee monoclonal antibody 5h2
PDB Compounds: (L:) Light chain, monoclonal antibody 5H2

SCOPe Domain Sequences for d3uc0l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uc0l2 b.1.1.2 (L:109-210) automated matches {Chimpanzee (Pan troglodytes) [TaxId: 9598]}
rtvaapsvfifppsdeqlksgtasvacllnnfypreakvqwkvdnalqsgnsqesvteqd
skdntyslsstltlskadyekhkvyacevthqglsspvtksf

SCOPe Domain Coordinates for d3uc0l2:

Click to download the PDB-style file with coordinates for d3uc0l2.
(The format of our PDB-style files is described here.)

Timeline for d3uc0l2: