SCOPe 2.06: Domain d3uc0l1: 3uc0 L:2-108

Lineage for d3uc0l1 (3uc0 L:2-108)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Chimpanzee (Pan troglodytes) [TaxId:9598] [226267] (1 PDB entry)

8. Domain d3uc0l1: 3uc0 L:2-108 [217273]
   Other proteins in same PDB: d3uc0l2, d3uc0m2
   automated match to d1rhha1
   complexed with gol, so4

Details for d3uc0l1

PDB Entry: 3uc0, 2.71 Å

PDB Description: crystal structure of domain i of the envelope glycoprotein ectodomain from dengue virus serotype 4 in complex with the fab fragment of the chimpanzee monoclonal antibody 5h2

PDB Compounds: (L:) Light chain, monoclonal antibody 5H2

SCOPe Domain Sequences for d3uc0l1:

Sequence; same for both SEQRES and ATOM records:

>d3uc0l1 b.1.1.0 (L:2-108) automated matches {Chimpanzee (Pan troglodytes) [TaxId: 9598]}
elqmtqspsslsasvgdrvtitcrasqdisirlnwyqqkpgkapklliydastlesgvps
rfsgsgsgtdftltisslqpedfatyycqqfnsypltfgggtkveik

Timeline for d3uc0l1:

• d3uc0l1 first appeared in SCOPe 2.03
  
• d3uc0l1 appears in SCOPe 2.05
  
• d3uc0l1 appears in SCOPe 2.07
  
• d3uc0l1 appears in the current release, SCOPe 2.08