Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (21 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [194605] (23 PDB entries) |
Domain d3ubda_: 3ubd A: [217270] automated match to d1blxa_ complexed with sl0 |
PDB Entry: 3ubd (more details), 1.53 Å
SCOPe Domain Sequences for d3ubda_:
Sequence, based on SEQRES records: (download)
>d3ubda_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} eiaithhvkeghekadpsqfellkvlgqgsfgkvflvkkisgsdarqlyamkvlkkatlk vrdrvrtkmerdilvevnhpfivklhyafqtegklylildflrggdlftrlskevmftee dvkfylaelalaldhlhslgiiyrdlkpenilldeeghikltdfglskesidhekkaysf cgtveymapevvnrrghtqsadwwsfgvlmfemltgtlpfqgkdrketmtmilkaklgmp qflspeaqsllrmlfkrnpanrlgagpdgveeikrhsffstidwnklyrreihppfkp
>d3ubda_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} eiaithhvkeghekadpsqfellkvlgqgsfgkvflvkkisgsdarqlyamkvlkkatlk vrdrvdilvevnhpfivklhyafqtegklylildflrggdlftrlskevmfteedvkfyl aelalaldhlhslgiiyrdlkpenilldeeghikltdfglskekkaysfcgtveymapev vnrrghtqsadwwsfgvlmfemltgtlpfqgkdrketmtmilkaklgmpqflspeaqsll rmlfkrnpanrlgagpdgveeikrhsffstidwnklyrreihppfkp
Timeline for d3ubda_: