SCOPe 2.03: Domain d3uaza_: 3uaz A:

Lineage for d3uaza_ (3uaz A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (12 species)

7. Species Bacillus cereus [TaxId:1396] [195935] (5 PDB entries)

8. Domain d3uaza_: 3uaz A: [217269]
   automated match to d3uaya_
   complexed with gol, nos, so4; mutant

Details for d3uaza_

PDB Entry: 3uaz, 1.4 Å

PDB Description: crystal structure of bacillus cereus adenosine phosphorylase d204n mutant complexed with inosine

PDB Compounds: (A:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d3uaza_:

Sequence; same for both SEQRES and ATOM records:

>d3uaza_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Bacillus cereus [TaxId: 1396]}
svhieakqgeiaesillpgdplrakyiaetfledvtcynnvrgmlgftgtykgkrvsvqg
tgmgvpsisiyvneliqsygvknlirvgtcgaiqkdvkvrdviiamtactdsnmnrltfp
gfdfapaanfdllkkaydagtekglhvrvgnvltadvfyresmdmvkklgdygvlaveme
ttalytlaakygvnalsvltvsnhiftgeettseerqttfnemieialdaaiq

Timeline for d3uaza_:

• d3uaza_ is new in SCOPe 2.03-stable
  
• d3uaza_ appears in SCOPe 2.04
  
• d3uaza_ appears in the current release, SCOPe 2.08