Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein Purine nucleoside phosphorylase, PNP [53169] (13 species) |
Species Bacillus cereus [TaxId:1396] [195935] (5 PDB entries) |
Domain d3uaxa_: 3uax A: [217268] automated match to d3uava_ complexed with gol, nos, so4 |
PDB Entry: 3uax (more details), 1.2 Å
SCOPe Domain Sequences for d3uaxa_:
Sequence, based on SEQRES records: (download)
>d3uaxa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Bacillus cereus [TaxId: 1396]} svhieakqgeiaesillpgdplrakyiaetfledvtcynnvrgmlgftgtykgkrvsvqg tgmgvpsisiyvneliqsygvknlirvgtcgaiqkdvkvrdviiamtactdsnmnrltfp gfdfapaanfdllkkaydagtekglhvrvgnvltadvfyresmdmvkklgdygvlaveme ttalytlaakygvnalsvltvsdhiftgeettseerqttfnemieialdaai
>d3uaxa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Bacillus cereus [TaxId: 1396]} svhieakqgeiaesillpgdplrakyiaetfledvtcynnvrgmlgftgtykgkrvsvqg tgmgvpsisiyvneliqsygvknlirvgtcgaiqkdvkvrdviiamtactdsnmnrltfp gfdfapaanfdllkkaydagtekglhvrvgnvltadvfyresmdmvkklgdygvlaveme ttalytlaakygvnalsvltvsdhifseerqttfnemieialdaai
Timeline for d3uaxa_: