Lineage for d3uaxa_ (3uax A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1860688Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1860705Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1860706Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1860816Protein Purine nucleoside phosphorylase, PNP [53169] (12 species)
  7. 1860824Species Bacillus cereus [TaxId:1396] [195935] (5 PDB entries)
  8. 1860826Domain d3uaxa_: 3uax A: [217268]
    automated match to d3uava_
    complexed with gol, nos, so4

Details for d3uaxa_

PDB Entry: 3uax (more details), 1.2 Å

PDB Description: Crystal structure of adenosine phosphorylase from Bacillus cereus complexed with inosine
PDB Compounds: (A:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d3uaxa_:

Sequence, based on SEQRES records: (download)

>d3uaxa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Bacillus cereus [TaxId: 1396]}
svhieakqgeiaesillpgdplrakyiaetfledvtcynnvrgmlgftgtykgkrvsvqg
tgmgvpsisiyvneliqsygvknlirvgtcgaiqkdvkvrdviiamtactdsnmnrltfp
gfdfapaanfdllkkaydagtekglhvrvgnvltadvfyresmdmvkklgdygvlaveme
ttalytlaakygvnalsvltvsdhiftgeettseerqttfnemieialdaai

Sequence, based on observed residues (ATOM records): (download)

>d3uaxa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Bacillus cereus [TaxId: 1396]}
svhieakqgeiaesillpgdplrakyiaetfledvtcynnvrgmlgftgtykgkrvsvqg
tgmgvpsisiyvneliqsygvknlirvgtcgaiqkdvkvrdviiamtactdsnmnrltfp
gfdfapaanfdllkkaydagtekglhvrvgnvltadvfyresmdmvkklgdygvlaveme
ttalytlaakygvnalsvltvsdhifseerqttfnemieialdaai

SCOPe Domain Coordinates for d3uaxa_:

Click to download the PDB-style file with coordinates for d3uaxa_.
(The format of our PDB-style files is described here.)

Timeline for d3uaxa_: