Lineage for d3uasa1 (3uas A:28-491)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005352Protein Mammalian cytochrome p450 2b4 [101375] (1 species)
  7. 2005353Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [101376] (10 PDB entries)
    Uniprot P00178
  8. 2005366Domain d3uasa1: 3uas A:28-491 [217267]
    Other proteins in same PDB: d3uasa2
    automated match to d1suoa_
    complexed with 0bv, cm5, hem, tam

Details for d3uasa1

PDB Entry: 3uas (more details), 2.94 Å

PDB Description: Cytochrome P450 2B4 covalently bound to the mechanism-based inactivator 9-ethynylphenanthrene
PDB Compounds: (A:) Cytochrome P450 2B4

SCOPe Domain Sequences for d3uasa1:

Sequence, based on SEQRES records: (download)

>d3uasa1 a.104.1.1 (A:28-491) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlcgtdairea
lvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdfgmgkrsveeriq
eearclveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrlldlffqsfs
lissfssqvfelfsgflkyfpgthrqiyrnlqeintfigqsvekhratldpsnprdfidv
yllrmekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyphvtervqke
ieqvigshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrgyvipknte
vfpvlssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclgegiartelf
lffttilqnfsiaspvppedidltpresgvgnvppsyqirflar

Sequence, based on observed residues (ATOM records): (download)

>d3uasa1 a.104.1.1 (A:28-491) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlcgtdairea
lvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdkrsveeriqeear
clveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrlldlffqsfsliss
fssqvfelfsgflkyfpgthrqiyrnlqeintfigqsvekhratldpsnprdfidvyllr
mekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyphvtervqkeieqv
igshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrgyvipkntevfpv
lssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclgegiartelflfft
tilqnfsiaspvppedidltpresgvgnvppsyqirflar

SCOPe Domain Coordinates for d3uasa1:

Click to download the PDB-style file with coordinates for d3uasa1.
(The format of our PDB-style files is described here.)

Timeline for d3uasa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uasa2