Lineage for d3uara2 (3uar A:81-202)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714082Species Methylococcus capsulatus [TaxId:243233] [226242] (2 PDB entries)
  8. 2714083Domain d3uara2: 3uar A:81-202 [217266]
    Other proteins in same PDB: d3uara1, d3uara3
    automated match to d2pmta1
    complexed with gol, gsh

Details for d3uara2

PDB Entry: 3uar (more details), 2.6 Å

PDB Description: crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath with gsh bound
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3uara2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uara2 a.45.1.0 (A:81-202) automated matches {Methylococcus capsulatus [TaxId: 243233]}
glmppsgtferyrllewlafisteihktfgpfwnpespeaskqialgllsrrldyvedrl
eaggpwlmgdrysvadaylstvlgwceylkidlskwprilaylernqarpavqaamkaeg
li

SCOPe Domain Coordinates for d3uara2:

Click to download the PDB-style file with coordinates for d3uara2.
(The format of our PDB-style files is described here.)

Timeline for d3uara2: