| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Methylococcus capsulatus [TaxId:243233] [226242] (2 PDB entries) |
| Domain d3uara2: 3uar A:81-202 [217266] Other proteins in same PDB: d3uara1, d3uara3 automated match to d2pmta1 complexed with gol, gsh |
PDB Entry: 3uar (more details), 2.6 Å
SCOPe Domain Sequences for d3uara2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uara2 a.45.1.0 (A:81-202) automated matches {Methylococcus capsulatus [TaxId: 243233]}
glmppsgtferyrllewlafisteihktfgpfwnpespeaskqialgllsrrldyvedrl
eaggpwlmgdrysvadaylstvlgwceylkidlskwprilaylernqarpavqaamkaeg
li
Timeline for d3uara2: