Lineage for d3uara1 (3uar A:1-80)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879986Species Methylococcus capsulatus [TaxId:243233] [226241] (2 PDB entries)
  8. 2879987Domain d3uara1: 3uar A:1-80 [217265]
    Other proteins in same PDB: d3uara2, d3uara3
    automated match to d2pmta2
    complexed with gol, gsh

Details for d3uara1

PDB Entry: 3uar (more details), 2.6 Å

PDB Description: crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath with gsh bound
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3uara1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uara1 c.47.1.0 (A:1-80) automated matches {Methylococcus capsulatus [TaxId: 243233]}
mklyyfpgacslaphivlreagldfelenvdlgtkktgsgadflqvnpkgyvpalqlddg
qvltedqvilqyladlkpes

SCOPe Domain Coordinates for d3uara1:

Click to download the PDB-style file with coordinates for d3uara1.
(The format of our PDB-style files is described here.)

Timeline for d3uara1: