SCOPe 2.03: Domain d3uapa1: 3uap A:0-80

Lineage for d3uapa1 (3uap A:0-80)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Methylococcus capsulatus [TaxId:243233] [226241] (2 PDB entries)

8. Domain d3uapa1: 3uap A:0-80 [217263]
   Other proteins in same PDB: d3uapa2
   automated match to d2pmta2
   complexed with gol

Details for d3uapa1

PDB Entry: 3uap, 2.8 Å

PDB Description: crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3uapa1:

Sequence; same for both SEQRES and ATOM records:

>d3uapa1 c.47.1.0 (A:0-80) automated matches {Methylococcus capsulatus [TaxId: 243233]}
vmklyyfpgacslaphivlreagldfelenvdlgtkktgsgadflqvnpkgyvpalqldd
gqvltedqvilqyladlkpes

Timeline for d3uapa1:

• d3uapa1 is new in SCOPe 2.03-stable
  
• d3uapa1 appears in SCOPe 2.04
  
• d3uapa1 appears in the current release, SCOPe 2.08