Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Methylococcus capsulatus [TaxId:243233] [226241] (2 PDB entries) |
Domain d3uapa1: 3uap A:1-80 [217263] Other proteins in same PDB: d3uapa2, d3uapa3 automated match to d2pmta2 complexed with gol |
PDB Entry: 3uap (more details), 2.8 Å
SCOPe Domain Sequences for d3uapa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uapa1 c.47.1.0 (A:1-80) automated matches {Methylococcus capsulatus [TaxId: 243233]} mklyyfpgacslaphivlreagldfelenvdlgtkktgsgadflqvnpkgyvpalqlddg qvltedqvilqyladlkpes
Timeline for d3uapa1: