Lineage for d3u9za2 (3u9z A:147-371)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883386Protein Actin [53073] (10 species)
  7. 2883430Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 2883474Domain d3u9za2: 3u9z A:147-371 [217260]
    automated match to d1qz5a2
    complexed with adp, mg; mutant

Details for d3u9za2

PDB Entry: 3u9z (more details), 2.09 Å

PDB Description: Crystal structure between actin and a protein construct containing the first beta-thymosin domain of drosophila ciboulot (residues 2-58) with the three mutations N26D/Q27K/D28S
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d3u9za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u9za2 c.55.1.1 (A:147-371) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivh

SCOPe Domain Coordinates for d3u9za2:

Click to download the PDB-style file with coordinates for d3u9za2.
(The format of our PDB-style files is described here.)

Timeline for d3u9za2: