| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein Actin [53073] (10 species) |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries) Uniprot P02568 ! SQ 02568 |
| Domain d3u9za2: 3u9z A:147-371 [217260] automated match to d1qz5a2 complexed with adp, mg; mutant |
PDB Entry: 3u9z (more details), 2.09 Å
SCOPe Domain Sequences for d3u9za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u9za2 c.55.1.1 (A:147-371) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivh
Timeline for d3u9za2: