Lineage for d1cvsc1 (1cvs C:149-250)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54308Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)
  7. 54309Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (3 PDB entries)
  8. 54310Domain d1cvsc1: 1cvs C:149-250 [21726]
    Other proteins in same PDB: d1cvsa_, d1cvsb_

Details for d1cvsc1

PDB Entry: 1cvs (more details), 2.8 Å

PDB Description: crystal structure of a dimeric fgf2-fgfr1 complex

SCOP Domain Sequences for d1cvsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvsc1 b.1.1.4 (C:149-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1}
mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvver

SCOP Domain Coordinates for d1cvsc1:

Click to download the PDB-style file with coordinates for d1cvsc1.
(The format of our PDB-style files is described here.)

Timeline for d1cvsc1: