Lineage for d3u96a_ (3u96 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875255Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2875600Protein automated matches [190252] (5 species)
    not a true protein
  7. 2875691Species Yersinia enterocolitica [TaxId:630] [226454] (1 PDB entry)
  8. 2875692Domain d3u96a_: 3u96 A: [217248]
    automated match to d1lyva_
    complexed with csn, so4

Details for d3u96a_

PDB Entry: 3u96 (more details), 1.8 Å

PDB Description: crystal structure of yophq357f(catalytic domain, residues 163-468) in complex with pncs
PDB Compounds: (A:) Tyrosine-protein phosphatase yopH

SCOPe Domain Sequences for d3u96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u96a_ c.45.1.2 (A:) automated matches {Yersinia enterocolitica [TaxId: 630]}
spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdftavssevtk
alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

SCOPe Domain Coordinates for d3u96a_:

Click to download the PDB-style file with coordinates for d3u96a_.
(The format of our PDB-style files is described here.)

Timeline for d3u96a_: