Lineage for d3u95f1 (3u95 F:1-191)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848866Species Thermotoga neapolitana [TaxId:309803] [226485] (1 PDB entry)
  8. 2848872Domain d3u95f1: 3u95 F:1-191 [217246]
    Other proteins in same PDB: d3u95a2, d3u95b2, d3u95c2, d3u95d2, d3u95e2, d3u95f2
    automated match to d1vjta1
    complexed with mn

Details for d3u95f1

PDB Entry: 3u95 (more details), 2 Å

PDB Description: Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana
PDB Compounds: (F:) Glycoside hydrolase, family 4

SCOPe Domain Sequences for d3u95f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u95f1 c.2.1.0 (F:1-191) automated matches {Thermotoga neapolitana [TaxId: 309803]}
mkisivgagsvrfalqlvediaqtdelsredthiylmdvherrlnasyilarkyveelns
pvkvvktesldeaiegadfiintaypydpryhdsgsqrwdevtkvgekhgyyrgidsqel
nmvstytyvlssypdvklaleiaekmkkmapkaylmqtanpvfeitqavrrwtganiigf
chgvagvyevf

SCOPe Domain Coordinates for d3u95f1:

Click to download the PDB-style file with coordinates for d3u95f1.
(The format of our PDB-style files is described here.)

Timeline for d3u95f1: