| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Thermotoga neapolitana [TaxId:309803] [226485] (1 PDB entry) |
| Domain d3u95c1: 3u95 C:2-191 [217240] Other proteins in same PDB: d3u95a2, d3u95b2, d3u95c2, d3u95d2, d3u95e2, d3u95f2 automated match to d1vjta1 complexed with mn |
PDB Entry: 3u95 (more details), 2 Å
SCOPe Domain Sequences for d3u95c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u95c1 c.2.1.0 (C:2-191) automated matches {Thermotoga neapolitana [TaxId: 309803]}
kisivgagsvrfalqlvediaqtdelsredthiylmdvherrlnasyilarkyveelnsp
vkvvktesldeaiegadfiintaypydpryhdsgsqrwdevtkvgekhgyyrgidsqeln
mvstytyvlssypdvklaleiaekmkkmapkaylmqtanpvfeitqavrrwtganiigfc
hgvagvyevf
Timeline for d3u95c1: