SCOPe 2.05: Domain d3u94d_: 3u94 D:

Lineage for d3u94d_ (3u94 D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (78 PDB entries)

8. Domain d3u94d_: 3u94 D: [217235]
   automated match to d3u93b_
   complexed with cl, glu, so4, zn

Details for d3u94d_

PDB Entry: 3u94, 1.96 Å

PDB Description: crystal structure of the gluk3 ligand binding domain complex with glutamate and zinc: p21212 form

PDB Compounds: (D:) Glutamate receptor, ionotropic kainate 3

SCOPe Domain Sequences for d3u94d_:

Sequence; same for both SEQRES and ATOM records:

>d3u94d_ c.94.1.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
snrslivttlleepfvmfrksdrtlygndrfegycidllkelahilgfsyeirlvedgky
gaqddkgqwngmvkelidhkadlavapltithvrekaidfskpfmtlgvsilyrkgtpid
saddlakqtkieygavkdgatmtffkkskistfekmwafmsskpsalvknneegiqrtlt
adyallmesttieyitqrncnltqigglidskgygigtpmgspyrdkitiailqlqeedk
lhimkekwwrgsgc

Timeline for d3u94d_:

• d3u94d_ first appeared in SCOPe 2.03
  
• d3u94d_ appears in SCOPe 2.04
  
• d3u94d_ is called d3u94d1 in SCOPe 2.06
  
• d3u94d_ appears in the current release, SCOPe 2.08, called d3u94d1