SCOPe 2.05: Domain d3u8xc1: 3u8x C:6-146

Lineage for d3u8xc1 (3u8x C:6-146)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (7 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (62 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d3u8xc1: 3u8x C:6-146 [217228]
   automated match to d1qz5a1
   complexed with atp, mg

Details for d3u8xc1

PDB Entry: 3u8x, 2 Å

PDB Description: crystal structure of a chimera containing the n-terminal domain (residues 8-29) of drosophila ciboulot and the c-terminal domain (residues 18-44) of bovine thymosin-beta4, bound to g-actin-atp

PDB Compounds: (C:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d3u8xc1:

Sequence, based on SEQRES records:

>d3u8xc1 c.55.1.1 (C:6-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
talvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil
tlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfe
tfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d3u8xc1 c.55.1.1 (C:6-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
talvcdngsglvkagfagddapravfpsivgrprhqdsyvgdeaqskrgiltlkypiehg
iitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyv
aiqavlslyasg

Timeline for d3u8xc1:

• d3u8xc1 first appeared in SCOPe 2.03
  
• d3u8xc1 appears in SCOPe 2.04
  
• d3u8xc1 appears in SCOPe 2.06
  
• d3u8xc1 appears in the current release, SCOPe 2.08