SCOPe 2.06: Domain d3u7yl1: 3u7y L:3-101

Lineage for d3u7yl1 (3u7y L:3-101)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3u7yl1: 3u7y L:3-101 [217218]
   automated match to d1sy6l1
   complexed with cl, flc, nag

Details for d3u7yl1

PDB Entry: 3u7y, 2.45 Å

PDB Description: structure of nih45-46 fab in complex with gp120 of 93th057 hiv

PDB Compounds: (L:) NIH45-46 light chain, Ig kappa chain C region

SCOPe Domain Sequences for d3u7yl1:

Sequence; same for both SEQRES and ATOM records:

>d3u7yl1 b.1.1.0 (L:3-101) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqspatlslspgetaiiscrtsqsgslawyqqrpgqaprlviysgstraagipdrfsg
srwgadynlsisnlesgdfgvyycqqyeffgqgtkvqvd

Timeline for d3u7yl1:

• d3u7yl1 first appeared in SCOPe 2.03
  
• d3u7yl1 appears in SCOPe 2.05
  
• d3u7yl1 appears in SCOPe 2.07
  
• d3u7yl1 appears in the current release, SCOPe 2.08