Lineage for d3u7ra_ (3u7r A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838447Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1838906Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 1838907Protein automated matches [190158] (18 species)
    not a true protein
  7. 1838991Species Paracoccus denitrificans [TaxId:318586] [226510] (1 PDB entry)
  8. 1838992Domain d3u7ra_: 3u7r A: [217214]
    automated match to d1t0ib_
    complexed with 2pe, fnr

Details for d3u7ra_

PDB Entry: 3u7r (more details), 1.4 Å

PDB Description: ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans
PDB Compounds: (A:) NADPH-dependent FMN reductase

SCOPe Domain Sequences for d3u7ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u7ra_ c.23.5.0 (A:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
vktvavmvgslrkdslnhklmkvlqklaegrlefhllhigdlphynddlwadapesvlrl
kdriehsdavlaitpeynrsypgmiknaidwatrpygqnswkgkpaavigtspgvigaal
aqarlkndllhvgtvmmsmpeayiqwhaeayaadgsvtdektakflqgfvdafvdwiekh
gl

SCOPe Domain Coordinates for d3u7ra_:

Click to download the PDB-style file with coordinates for d3u7ra_.
(The format of our PDB-style files is described here.)

Timeline for d3u7ra_: