SCOPe 2.03: Domain d3u6vb2: 3u6v B:81-210

Lineage for d3u6vb2 (3u6v B:81-210)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (28 PDB entries)
   Uniprot P08263

8. Domain d3u6vb2: 3u6v B:81-210 [217213]
   Other proteins in same PDB: d3u6va1, d3u6vb1
   automated match to d1agsa1
   mutant

Details for d3u6vb2

PDB Entry: 3u6v, 2.2 Å

PDB Description: Crystal Structure Analysis of L23A mutant of human GST A1-1

PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d3u6vb2:

Sequence; same for both SEQRES and ATOM records:

>d3u6vb2 a.45.1.1 (B:81-210) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmde

Timeline for d3u6vb2:

• d3u6vb2 is new in SCOPe 2.03-stable
  
• d3u6vb2 appears in SCOPe 2.04
  
• d3u6vb2 appears in the current release, SCOPe 2.08