Lineage for d3u6rb_ (3u6r B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756142Domain d3u6rb_: 3u6r B: [217207]
    automated match to d1sjxa_
    complexed with so4

Details for d3u6rb_

PDB Entry: 3u6r (more details), 2.67 Å

PDB Description: Three dimensional structure of broadly neutralizing anti - Hepatitis C virus (HCV) glycoprotein E2 single chain FV fragment 1:7
PDB Compounds: (B:) Antibody 1:7 (Light chain)

SCOPe Domain Sequences for d3u6rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u6rb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeltqspatlslspgeratlscrasqsvnkylawyqqkpgqaprlliydasnratgipar
fsgsgsgtdftltisnlepedfavyycqqrsdwvtfgggtkveik

SCOPe Domain Coordinates for d3u6rb_:

Click to download the PDB-style file with coordinates for d3u6rb_.
(The format of our PDB-style files is described here.)

Timeline for d3u6rb_: