![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species) PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103301] (67 PDB entries) |
![]() | Domain d3u6ia_: 3u6i A: [217205] automated match to d3u6ha_ complexed with 044 |
PDB Entry: 3u6i (more details), 2.1 Å
SCOPe Domain Sequences for d3u6ia_:
Sequence, based on SEQRES records: (download)
>d3u6ia_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} vhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavk slnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfir nethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmy dkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntf ditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyv h
>d3u6ia_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} vhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavk slnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfir nethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglpvkwm aleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpd plyevmlkcwhpkaemrpsfselvsrisaifstfigehyvh
Timeline for d3u6ia_: