SCOPe 2.08: Domain d3u54b_: 3u54 B:

Lineage for d3u54b_ (3u54 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.143.1: SAICAR synthase-like [56104] (4 families)
   shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies

5. Family d.143.1.0: automated matches [191445] (1 protein)
   not a true family

6. Protein automated matches [190664] (8 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [194472] (16 PDB entries)

8. Domain d3u54b_: 3u54 B: [217200]
   automated match to d3u55a_
   complexed with act, bu1, cd, so4

Details for d3u54b_

PDB Entry: 3u54, 2.35 Å

PDB Description: Crystal structure (Type-1) of SAICAR synthetase from Pyrococcus horikoshii OT3

PDB Compounds: (B:) phosphoribosylaminoimidazole-succinocarboxamide synthase

SCOPe Domain Sequences for d3u54b_:

Sequence; same for both SEQRES and ATOM records:

>d3u54b_ d.143.1.0 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
akkmipidddklimefkddatafdgtkkarfkgkgwlnaqlsviffklleehgikthfig
vaggnrlivekldmyplevvvrnvvagslkkrlplpegyelpepivelyykndelhdpmi
nyyhakvlgisldeikkieeialkvneilkdylakkgiilvdfklefgkdkngdivlade
ispdtcrfwdaktkrsldkdvfrfdkgdlieaykeiyeritgekp

Timeline for d3u54b_:

• d3u54b_ first appeared in SCOPe 2.03
  
• d3u54b_ appears in SCOPe 2.07