SCOPe 2.05: Domain d1itbb1: 1itb B:6-101

Lineage for d1itbb1 (1itb B:6-101)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Type-1 interleukin-1 receptor [49177] (1 species)
   duplication: tandem repeat of 3 domains

7. Species Human (Homo sapiens) [TaxId:9606] [49178] (4 PDB entries)

8. Domain d1itbb1: 1itb B:6-101 [21720]
   Other proteins in same PDB: d1itba_

Details for d1itbb1

PDB Entry: 1itb, 2.5 Å

PDB Description: type-1 interleukin-1 receptor complexed with interleukin-1 beta

PDB Compounds: (B:) type 1 interleukin-1 receptor

SCOPe Domain Sequences for d1itbb1:

Sequence; same for both SEQRES and ATOM records:

>d1itbb1 b.1.1.4 (B:6-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
ckereekiilvssaneidvrpcplnpnehkgtitwykddsktpvsteqasrihqhkeklw
fvpakvedsghyycvvrnssyclrikisakfvenep

Timeline for d1itbb1:

• d1itbb1 first appeared (with stable ids) in SCOP 1.55
  
• d1itbb1 appears in SCOPe 2.04
  
• d1itbb1 appears in SCOPe 2.06
  
• d1itbb1 appears in the current release, SCOPe 2.08