Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Type-1 interleukin-1 receptor [49177] (1 species) duplication: tandem repeat of 3 domains |
Species Human (Homo sapiens) [TaxId:9606] [49178] (4 PDB entries) |
Domain d1itbb1: 1itb B:6-101 [21720] Other proteins in same PDB: d1itba_ |
PDB Entry: 1itb (more details), 2.5 Å
SCOPe Domain Sequences for d1itbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1itbb1 b.1.1.4 (B:6-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} ckereekiilvssaneidvrpcplnpnehkgtitwykddsktpvsteqasrihqhkeklw fvpakvedsghyycvvrnssyclrikisakfvenep
Timeline for d1itbb1: