Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein c-src tyrosine kinase [56155] (2 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
Species Chicken (Gallus gallus) [TaxId:9031] [56157] (37 PDB entries) |
Domain d3u51a_: 3u51 A: [217197] automated match to d2etmb_ protein/DNA complex; complexed with 08x |
PDB Entry: 3u51 (more details), 2.24 Å
SCOPe Domain Sequences for d3u51a_:
Sequence, based on SEQRES records: (download)
>d3u51a_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]} eipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrhe klvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayverm nyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygrft iksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwr kdpeerptfeylqafledyftstepqyqpgenl
>d3u51a_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]} eipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrhe klvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayverm nyvhrdlraanilvgenlvckvadfgfpikwtapeaalygrftiksdvwsfgillteltt kgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafle dyftstepqyqpgenl
Timeline for d3u51a_: