Lineage for d1iray3 (1ira Y:205-311)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9408Family b.1.1.4: I set domains [49159] (21 proteins)
  6. 9568Protein Type-1 interleukin-1 receptor [49177] (1 species)
  7. 9569Species Human (Homo sapiens) [TaxId:9606] [49178] (3 PDB entries)
  8. 9572Domain d1iray3: 1ira Y:205-311 [21719]
    Other proteins in same PDB: d1irax_

Details for d1iray3

PDB Entry: 1ira (more details), 2.7 Å

PDB Description: complex of the interleukin-1 receptor with the interleukin-1 receptor antagonist (il1ra)

SCOP Domain Sequences for d1iray3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens)}
rpvivspanetmevdlgsqiqlicnvtgqlsdiaywkwngsvideddpvlgedyysvenp
ankrrstlitvlniseiesrfykhpftcfaknthgidaayiqliypv

SCOP Domain Coordinates for d1iray3:

Click to download the PDB-style file with coordinates for d1iray3.
(The format of our PDB-style files is described here.)

Timeline for d1iray3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1irax_