SCOP 1.65: Domain d1iray1: 1ira Y:1-101

Lineage for d1iray1 (1ira Y:1-101)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (29 proteins)

6. Protein Type-1 interleukin-1 receptor [49177] (1 species)
   duplication: tandem repeat of 3 domains

7. Species Human (Homo sapiens) [TaxId:9606] [49178] (3 PDB entries)

8. Domain d1iray1: 1ira Y:1-101 [21717]
   Other proteins in same PDB: d1irax_

Details for d1iray1

PDB Entry: 1ira, 2.7 Å

PDB Description: complex of the interleukin-1 receptor with the interleukin-1 receptor antagonist (il1ra)

SCOP Domain Sequences for d1iray1:

Sequence; same for both SEQRES and ATOM records:

>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens)}
dkckereekiilvssaneidvrpcplnpnehkgtitwykddsktpvsteqasrihqhkek
lwfvpakvedsghyycvvrnssyclrikisakfvenepnlc

Timeline for d1iray1:

• d1iray1 first appeared (with stable ids) in SCOP 1.55
  
• d1iray1 appears in SCOP 1.63
  
• d1iray1 appears in SCOP 1.67
  
• d1iray1 appears in the current release, SCOPe 2.08