Lineage for d3u3ax_ (3u3a X:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077896Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2077897Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2077898Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2077899Protein Carbonic anhydrase [51071] (10 species)
  7. 2077938Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (682 PDB entries)
    Uniprot P00918
  8. 2078095Domain d3u3ax_: 3u3a X: [217167]
    automated match to d3u7ca_
    complexed with gol, zn

Details for d3u3ax_

PDB Entry: 3u3a (more details), 1.55 Å

PDB Description: structure of human carbonic anhydrase ii v143i
PDB Compounds: (X:) Carbonic anhydrase 2

SCOPe Domain Sequences for d3u3ax_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u3ax_ b.74.1.1 (X:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglailgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOPe Domain Coordinates for d3u3ax_:

Click to download the PDB-style file with coordinates for d3u3ax_.
(The format of our PDB-style files is described here.)

Timeline for d3u3ax_: