Lineage for d3u30e2 (3u30 E:108-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751512Domain d3u30e2: 3u30 E:108-211 [217166]
    Other proteins in same PDB: d3u30a1, d3u30a2, d3u30a3, d3u30b1, d3u30c_, d3u30d1, d3u30d2, d3u30e1, d3u30f_
    automated match to d1rhha2

Details for d3u30e2

PDB Entry: 3u30 (more details), 2.43 Å

PDB Description: crystal structure of a linear-specific ubiquitin fab bound to linear ubiquitin
PDB Compounds: (E:) Light chain Fab

SCOPe Domain Sequences for d3u30e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u30e2 b.1.1.2 (E:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d3u30e2:

Click to download the PDB-style file with coordinates for d3u30e2.
(The format of our PDB-style files is described here.)

Timeline for d3u30e2: