SCOPe 2.08: Domain d3u2ib1: 3u2i B:12-124

Lineage for d3u2ib1 (3u2i B:12-124)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
   Uniprot P02766 31-143

8. Domain d3u2ib1: 3u2i B:12-124 [217155]
   Other proteins in same PDB: d3u2ia2, d3u2ib2
   automated match to d2roya_

Details for d3u2ib1

PDB Entry: 3u2i, 1.7 Å

PDB Description: X-ray crystal structure of human Transthyretin at room temperature

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d3u2ib1:

Sequence; same for both SEQRES and ATOM records:

>d3u2ib1 b.3.4.1 (B:12-124) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
lmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiykv
eidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

Timeline for d3u2ib1:

• d3u2ib1 first appeared in SCOPe 2.03, called d3u2ib_
  
• d3u2ib1 appears in SCOPe 2.07