Lineage for d3u1ra1 (3u1r A:20-261)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570586Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 2570616Protein automated matches [227100] (1 species)
    not a true protein
  7. 2570617Species Flavobacterium sp. [TaxId:686394] [226517] (2 PDB entries)
  8. 2570618Domain d3u1ra1: 3u1r A:20-261 [217150]
    Other proteins in same PDB: d3u1ra2
    automated match to d1g9ka2
    complexed with ca, zn

Details for d3u1ra1

PDB Entry: 3u1r (more details), 2 Å

PDB Description: Structure Analysis of A New Psychrophilic Marine Protease
PDB Compounds: (A:) Alkaline metalloprotease

SCOPe Domain Sequences for d3u1ra1:

Sequence, based on SEQRES records: (download)

>d3u1ra1 d.92.1.6 (A:20-261) automated matches {Flavobacterium sp. [TaxId: 686394]}
gtssaftqvdnfshfydrgnhlvngkpsftvdqaadqltrsgaswydlngdgvinlsytf
ltspppgyasrglgtfssfsglqkeqaklsleswadvakvtftegpaargddghmtfanf
sasnggaafaylpnssrkgeswylinkdydvnktpgegnygrqtltheightlglshpgd
ynagngnpsyrdavygedtraysvmsywsekntgqvftktgegayasapllddiaavqkl
yg

Sequence, based on observed residues (ATOM records): (download)

>d3u1ra1 d.92.1.6 (A:20-261) automated matches {Flavobacterium sp. [TaxId: 686394]}
gtssaftqvdnfshfydrgnhlvngkpsftvdqaadqltrsgaswydlngdgvinlsytf
ltspppgyasrglgtfssfsglqkeqaklsleswadvakvtftegpaargddghmtfanf
sasnggaafaylpnssrkgeswylinkdydvnktpgegnygrqtltheightlglshpgd
ynpsyrdavygedtraysvmsywsekntgqvftktgegayasapllddiaavqklyg

SCOPe Domain Coordinates for d3u1ra1:

Click to download the PDB-style file with coordinates for d3u1ra1.
(The format of our PDB-style files is described here.)

Timeline for d3u1ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3u1ra2